XML, XSL, XSL-FO and tables problem
CodeGuru Home VC++ / MFC / C++ .NET / C# Visual Basic VB Forums Developer.com
Results 1 to 2 of 2

Thread: XML, XSL, XSL-FO and tables problem

  1. #1
    Join Date
    Apr 2010
    Posts
    1

    Question XML, XSL, XSL-FO and tables problem

    hello guys!

    i'm quite new here and i'm probably posting this on the wrong place, but hey, here goes nothing! :P

    so, i have this lovely XML (not!) that was obtained through a yahoo pipe, and had a JSON decode, in order to transform it in a XML that could be stored in a MySQL database.

    Code:
    <?xml version="1.0" encoding="ISO-8859-1"?>
    <json>
      <count>16</count>
      <value>
        <title>uniprot 7</title>
        <description>Pipes Output</description>
        <link>http://pipes.yahoo.com/pipes/pipe.info?_id=0ef2cf38a34d6aef3392b6996ef41108</link>
        <pubDate>Sat, 03 Apr 2010 19:17:42 +0000</pubDate>
        <generator>http://pipes.yahoo.com/pipes/</generator>
        <callback />
        <items>
          <content>BPTF_HUMAN</content>
          <description />
          <title />
        </items>
        <items>
          <alternativeName>
            <fullName>Bromodomain and PHD finger-containing transcription factor</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Fetal Alzheimer antigen</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Fetal Alz-50 clone 1 protein</fullName>
          </alternativeName>
          <recommendedName>
            <fullName>Nucleosome-remodeling factor subunit BPTF</fullName>
          </recommendedName>
          <description />
          <title />
        </items>
        <items>
          <name>
            <content>BPTF</content>
            <type>primary</type>
          </name>
          <name>
            <content>FAC1</content>
            <type>synonym</type>
          </name>
          <name>
            <content>FALZ</content>
            <type>synonym</type>
          </name>
          <description />
          <title />
        </items>
        <items>
          <content>MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAP
    KTRLSSPRGGSSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRA
    VNKVVYDDHESEEEEEEEDMVSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEME
    DDDDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPN
    EHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDT
    SNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENK
    IKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPP
    LEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIE
    EDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNK
    ARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQ
    SLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSPVGC
    LSETPDSSNMAEKKVASELPQDVPEEPNKTCESSNTSATTTSIQPNLENSNSSSELNSSQ
    SESAKAADDPENGERESHTPVSIQEEIVGDFKSEKSNGELSESPGAGKGASGSTRIITRL
    RNPDSKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYF
    KLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKV
    LTISTLRLTITQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPV
    VMLPIWRESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWK
    QKGEEYRVTGYGGWSWISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNMDENMDESDKRKC
    SRSPKKIKIEPDSEKDEVKGSDAAKGADQNEMDISKITEKKDQDVKELLDSDSDKPCKEE
    PMEVDDDMKTESHVNCQESSQVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIKQFTLE
    EKQRLEKIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSMRQEQSPNANNDQPE
    DLIQGCSESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIEEKVS
    DLASRGQEPSKSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALH
    SSVPKSTNDRDATPLSRAMDFEGKLGCDSESNSTLENSSDTVSIQDSSEEDMIVQNSNES
    ISEQFRTREQDVEVLEPLKCELVSGESTGNCEDRLPVKGTEANGKKPSQQKKLEERPVNK
    CSDQIKLKNTTDKKNNENRESEKKGQRTSTFQINGKDNKPKIYLKGECLKEISESRVVSG
    NVEPKVNNINKIIPENDIKSLTVKESAIRPFINGDVIMEDFNERNSSETKSHLLSSSDAE
    GNYRDSLETLPSTKESDSTQTTTPSASCPESNSVNQVEDMEIETSEVKKVTSSPITSEEE
    SNLSNDFIDENGLPINKNENVNGESKRKTVITEVTTMTSTVATESKTVIKVEKGDKQTVV
    SSTENCAKSTVTTTTTTVTKLSTPSTGGSVDIISVKEQSKTVVTTTVTDSLTTTGGTLVT
    SMTVSKEYSTRDKVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARK
    GGIREVPYFNYNAKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWD
    DMAAKAPPGGGTTRTETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPETPKET
    PTPQRKGLRSSALRPKRPETPKQTGPVIIETWVAEEELELWEIRAFAERVEKEKAQAVEQ
    QAKKRLEQQKPTVIATSTTSPTSSTTSTISPAQKVMVAPISGSVTTGTKMVLTTKVGSPA
    TVTFQQNKNFHQTFATWVKQGQSNSGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRTATVT
    IRPNTSGSGGTTSNSQVITGPQIRPGMTVIRTPLQQSTLGKAIIRTPVMVQPGAPQQVMT
    QIIRGQPVSTAVSAPNTVSSTPGQKSLTSATSTSNIQSSASQPPRPQQGQVKLTMAQLTQ
    LTQGHGGNQGLTVVIQGQGQTTGQLQLIPQGVTVLPGPGQQLMQAAMPNGTVQRFLFTPL
    ATTATTASTTTTTVSTTAAGTGEQRQSKLSPQMQVHQDKTLPPAQSSSVGPAEAQPQTAQ
    PSAQPQPQTQPQSPAQPEVQTQPEVQTQTTVSSHVPSEAQPTHAQSSKPQVAAQSQPQSN
    VQGQSPVRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPIPIQPHTSLQIPSQGQPQSQ
    PQVQSSTQTLSSGQTLNQVTVSSPSRPQLQIQQPQPQVIAVPQLQQQVQVLSQIQSQVVA
    QIQAQQSGVPQQIKLQLPIQIQQSSAVQTHQIQNVVTVQAASVQEQLQRVQQLRDQQQKK
    KQQQIEIKREHTLQASNQSEIIQKQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQV
    MKYILDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLD
    KDLQIEVQEELKRDLKIKKEKDLMQLAQATAVAAPCPPVTPAPPAPPAPPPSPPPPPAVQ
    HTGLLSTPTLPAASQKRKREEEKDSSSKSKKKKMISTTSKETKKDTKLYCICKTPYDESK
    FYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVL
    RSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIF
    DNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS</content>
          <description />
          <title />
        </items>
        <items>
          <content>Q16EU1_AEDAE</content>
          <description />
          <title />
        </items>
        <items>
          <submittedName>
            <fullName>Fetal alzheimer antigen, falz</fullName>
          </submittedName>
          <description />
          <title />
        </items>
        <items>
          <name>
            <content>AAEL015015</content>
            <type>ORF</type>
          </name>
          <name>
            <content>AaeL_AAEL015015</content>
            <type>ORF</type>
          </name>
          <description />
          <title />
        </items>
        <items>
          <content>MSSRKSAAAAGEGSSAGKRRGRPPKSQSSAMERPKSKFQYHLLKKPKYLCKDGSNGDSRF
    STPSASRASSPQGSEESRPSTSRRSAPAKAPRSAKAAKGRKSTGGRGRGGNNRKSYTYHE
    SEYHYGSDFGDDSDKSDGYDDSMRSASDSEDSLANESESDFSIHSFSASTGIICQKEPSP
    DPVWLQDRDYPPLELPASSEDLLVPNNIVLKCTSIYEIIRRFRNLVRLSPFRLEDFAAAI
    MCEDQSPLLTEIHIMLLKAILREEDSQQTHFAPLDQKDSVNIALYLIDSITWPEVLRSYI
    ESDPSLDQQVLEVLTVNEYPFVAPEDRLKVLQFLTDQFLVTTTVRDDMLQEGPIHYDDHC
    RICHRLGDLLCCETCPAVFHLECVDPPLVDVPSEDWQCNLCKLHKVSGVMDCITSQEKQG
    MLCRQELLGYDRHGRKYWFIGRRIFIETEDSSDVWYFSTVKQFEYLLSKLDPVDLEMHLC
    KELDERRDEIIRHMTLTETITSQQKGNKKSYFELDNQRLEKLMEEEGLATKDADEKMDVD
    DQKGAGDKDEESRLTRNKLTQISNGTLHFKLGMENGFKAYVNQYSINPIALNKPQRNEDR
    DKKRHLSHKFSLTQASEFKWLGGGMNSTQTQIISTIKQSIIALEQAVASPFLHQNWSKLR
    KTWIGAISACTKAKDFARILCILQACMRSVIFASVWHEQLGHTKMYKITSAEREEKKKLE
    KREKRERDDEEERNRSTFNFVKYSLGLRHQVWKQKGEEYRIHGQWDWVWMSYSRRKGKKP
    SRETNEISHVLIPIVAEVHKKLLKLDSKTHKAYQLVRVGSTDLDFMTGNEALDSRLEEKF
    NQTETFQVPETFDVIDVSKALSTPGGRILYPKIAKTASVLDGLLQRRVDLKEAEERKIAK
    VKDEEDISVNVIHKPETVQARLGECVEKQLQSIINSRHNVNVRNSLPLNKQPINRSNGEQ
    VEPLIEKILPLRSKYQDVNAVVQTNKCYSLDCENGLCYSPLCLQKQAIKDELLPLLKKVQ
    ALQSTPMANPTIAGVKSILEQKLTEYKAENFDSMLANFSMNRYRSILDEWDSAHMHLIEY
    DEQLIQSMAAPKMPEEHNNNVTNEVEIKTEDAPDMVVKEEIVSTEGEPDLNGSERMDDSL
    KLNENSNSISENSCDEPRSTRRGRPRSSKNNSMVIEDTEVKVKEEEVMILPKKEHKPNRR
    FALPSRCVKKEDSEDKELAPDGSTRVYSVSSTKGKIYLRKALEPEVKVKSETKPAAAVVG
    PVKPKYPAVNYFWTRKQTTSMMVLPMHELLKLARNGGRLSAAGFHHMAKNNNSVWPYPCA
    RPLFKTCWLYRTLNLSTLSAVGLQLRIIWTCLRWDDMAMKPATSDGKHQVTTESEIMSLE
    ILKHRFAGIFHERMQYLRRKVVIPLELPKTVREVQSIRSGLRKRKRAESPQQTEPQVSEE
    WIDEDKLELWEIKLYGEKQEKLAAAQAQHVTRTSTGKLPITRQTPSTSGESSNSSTSTTS
    GNSGNNASTTNVQNKSAVISSKASREEITEKMEQQLRIQRAAHNQKRAMELKQQDGATPP
    KQTIVQRRIIVKNADGTTKVIQQNITQPARASPASATTAATSSPQAQQASPAPAKPDGPQ
    KVQIIRGPDGKVSVRGLNPGQQLIQTADGKLHVLSAAPATSVTVTSPTAVTQPQPQQIQV
    QPQQVQIQPQQQAAPVVVSSPTVTQQIVNKSPSIVVRNQAGQPIKQIIQKQVVQKVSLRN
    CGQLIATTGSPVQKVVTQSNLQQLLQGAGQKVVVESNTGQSPVQTQKVLVATSPPGQPVQ
    KQILIQNATPGSPQQIIINQAGGQKVVQQIVASPGQQIMIGGQRIMIGGGQKIISNQPIQ
    IQQNQQIQQIQQIQQVQQKVQQVHQIVTSTPQPQQPQQIQIQIQQPVAQPPPQPQLQTIQ
    AQPAPLTQGQSLTQQLSSGKLQLANLNGQQVLIRPLGNNQAQVVAHIKTQPNGTAQIIPL
    ANAVDPPPAPVQPQTIQQVVQAAPTQQATIQQVVQQPVTQTTIVQQAFNTSGGSQTTFQQ
    LAAATQQQQLQQQQQQQQLDPVEQTLLQGQPPGTVIKCVTAQVIQTQQGPRIVLQGLQGS
    EFTPQQSALVQQQVKQQLLKAQESNGKQGVLGPTKIYLAIQPSQQQVVAAQPPPLAPVQI
    KHDGGTTHIQLHQQVSSHQESRYYTSRSYFILQADSTVTTTTPTVEDSELPVSGSLTTTI
    KTAASTSNNDNKPQILSNIVINDAKTSEEKDDSFVVTPDYIQQTIKNALKQENLNPEIEE
    KLLNLQRYQEKQMKTDDRSAAIALQHNYSNMSSNREHHHHHSTPVKSKKRSHRGEDDDDE
    WMMDTPKRRPTKSGGSSLSSVERKAQLNRHKEQLKKDILKKRSHLERELQVQIQKELSTE
    LAARCKQEQQQIKQEHSGKQHATAAATPSTPAEKGSHSKKRSSASVSKEDKVQKTPKHAQ
    GSSKAEKASKASGKKGSKKKEKILCLCRTPYDDTKFYVGCDLCHNWFHGDCVGISEEQSK
    EIDEFVCSECKHARETQELYCLCKQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDE
    YICPNCQINNSVNFANMKSLSAKEFDNLKKLIKQIQHHKSAWPFMEPVDPDEAPDYYRVI
    KEPMDLQKVENKVNNQTYHTLSEFIGDMTKIFDNCRYYNPKESQFYRCAESLESFFVQKI
    KFFRENLVEKKSAGTSSTSTSV</content>
          <description />
          <title />
        </items>
        <items>
          <content>FLNB_HUMAN</content>
          <description />
          <title />
        </items>
        <items>
          <alternativeName>
            <fullName>Beta-filamin</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Actin-binding-like protein</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Thyroid autoantigen</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Truncated actin-binding protein</fullName>
            <shortName>Truncated ABP</shortName>
          </alternativeName>
          <alternativeName>
            <fullName>ABP-280 homolog</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>ABP-278</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Filamin-3</fullName>
          </alternativeName>
          <alternativeName>
            <fullName>Filamin homolog 1</fullName>
            <shortName>Fh1</shortName>
          </alternativeName>
          <recommendedName>
            <fullName>Filamin-B</fullName>
            <shortName>FLN-B</shortName>
          </recommendedName>
          <description />
          <title />
        </items>
        <items>
          <name>
            <content>FLNB</content>
            <type>primary</type>
          </name>
          <name>
            <content>FLN1L</content>
            <type>synonym</type>
          </name>
          <name>
            <content>FLN3</content>
            <type>synonym</type>
          </name>
          <name>
            <content>TABP</content>
            <type>synonym</type>
          </name>
          <name>
            <content>TAP</content>
            <type>synonym</type>
          </name>
          <description />
          <title />
        </items>
        <items>
          <content>MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
    RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
    YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
    GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
    KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
    EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
    GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
    MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
    AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
    VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
    DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
    IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
    VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
    IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
    PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
    NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
    DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
    DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
    CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
    PGLEHGKVGEAGLLSVNCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
    MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
    VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
    AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
    GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
    QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNMVDNGDGTHTVTYTPSQEGPYMVSVKYADE
    EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
    GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
    GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
    PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
    GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
    KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
    PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
    GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
    NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
    GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
    RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
    EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
    AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
    IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
    DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
    IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
    HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
    GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
    YVLAVKWGEEHIPGSPFHVTVP</content>
          <description />
          <title />
        </items>
        <items>
          <content>LRRK2_HUMAN</content>
          <description />
          <title />
        </items>
        <items>
          <alternativeName>
            <fullName>Dardarin</fullName>
          </alternativeName>
          <recommendedName>
            <fullName>Leucine-rich repeat serine/threonine-protein kinase 2</fullName>
            <ref>1</ref>
          </recommendedName>
          <description />
          <title />
        </items>
        <items>
          <name>
            <content>LRRK2</content>
            <type>primary</type>
          </name>
          <name>
            <content>PARK8</content>
            <type>synonym</type>
          </name>
          <description />
          <title />
        </items>
        <items>
          <content>MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI
    HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK
    MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
    CKALHVLFERVSEEQLTEFVENKDYMILLSASTNFKDEEEIVLHVLHCLHSLAIPCNNVE
    VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
    QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
    RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
    ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
    AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
    DIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
    EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA
    SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
    NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
    KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
    RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
    SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
    SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQ
    NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTV
    KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNH
    ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
    LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
    PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIR
    FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI
    RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
    RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL
    RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN
    QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK
    HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
    ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
    NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
    CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI
    LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
    LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
    GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
    PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
    CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
    NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ
    SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV
    KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
    SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
    NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
    AQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
    MRRTSVE</content>
          <description />
          <title />
        </items>
      </value>
    </json>

    then, when retrieved from the database, it would be formated with this XSL:
    Code:
    <?xml version="1.0" encoding="ISO-8859-1"?>
    <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform">
    <xsl:template match="/">
      <html>
      <body>
      <font size="1" face="Verdana">
      <h2>Titulo</h2>
    	<table border="1" 
    	cellspacing="0"
    	cellpadding="5">
          <tr bgcolor="#699C4D">
            <th>Protein name</th>
    		<th>gene name</th>
    		<th>sequence</th>
          </tr>
          <xsl:for-each select="/json/value/items">
          <tr>
            <td><xsl:value-of select="recommendedName/fullName"/></td>
            <td><xsl:value-of select="name/content"/></td>
    		<td><xsl:value-of select="content"/></td>
          </tr>
          </xsl:for-each>
        </table>
      </font>
      </body>
      </html>
    </xsl:template>
    </xsl:stylesheet>
    at this moment, i'm using a php script to this to with the two files, and the result is a messed table, but it's a table!


    so, in order to prevent this, i tried to use the same XML and a XSL-FO code to format it:
    Code:
    <?xml version="1.0" encoding="UTF-8"?>
    
    <xsl:stylesheet version="1.0"
    	xmlns:xsl="http://www.w3.org/1999/XSL/Transform"
    	xmlns:fo="http://www.w3.org/1999/XSL/Format"
    	xmlns:xs="http://www.w3.org/2001/XMLSchema">
    
    	<xsl:template match="/">
    		<fo:root xmlns:fo="http://www.w3.org/1999/XSL/Format">
    			<html>
    				<body>
    					<font face="Verdana" size="1">
    						<h2>XSL-FO (devia ser FUUUUUUUUU!)</h2>
    						<fo:table-and-caption>
    							<fo:table border="solid">
    
    								<fo:table-column border="0.5pt solid black" column-width="25mm"></fo:table-column>
    								<fo:table-column border="0.5pt solid black" column-width="25mm"></fo:table-column>
    								<fo:table-column border="0.5pt solid black" column-width="25mm"></fo:table-column>
    
    								<fo:table-header>
    									<fo:table-row>
    										<fo:table-cell>
    											<fo:block font-weight="bold">Protein name</fo:block>
    										</fo:table-cell>
    										<fo:table-cell>
    											<fo:block font-weight="bold">Gene Name</fo:block>
    										</fo:table-cell>
    										<fo:table-cell>
    											<fo:block font-weight="bold">Sequence</fo:block>
    										</fo:table-cell>
    									</fo:table-row>
    								</fo:table-header>
    
    								<fo:table-body>
    									<fo:table-row>
    										<!--><xsl:for-each select="/json/value/items"><-->
    										<fo:table-cell>
    											<fo:block>
    												<!--><xsl:value-of select="recommendedName/fullName"/><-->Coluna 1</fo:block>
    										</fo:table-cell>
    										<fo:table-cell>
    											<fo:block>
    												<!--><xsl:value-of select="name/content"/><-->Coluna 2</fo:block>
    										</fo:table-cell>
    										<fo:table-cell>
    											<fo:block>
    												<!--><xsl:value-of select="content"/><-->Coluna 3</fo:block>
    										</fo:table-cell>
    										<!--></xsl:for-each><-->
    									</fo:table-row>
    								</fo:table-body>
    							</fo:table>
    						</fo:table-and-caption>
    					</font>
    				</body>
    			</html>
    		</fo:root>
    	</xsl:template>
    </xsl:stylesheet>
    i have the foreach commented, because i didn't need it to perform any action while the table wasn't working, but i've tested it before and i know it works and that it fetches data from the XML.

    when i put it to work in a browser, all i get is this:

    no columns! :|

    what on earth am i doing wrong? any tips on this last piece of code or how can i improve the simple XSL?

    best regards!

  2. #2
    Join Date
    May 2010
    Posts
    1

    Re: XML, XSL, XSL-FO and tables problem

    I am not specialist in it, but I know that php form cooperates with php form.

Tags for this Thread

Posting Permissions

  • You may not post new threads
  • You may not post replies
  • You may not post attachments
  • You may not edit your posts
  •  


Azure Activities Information Page

Windows Mobile Development Center


Click Here to Expand Forum to Full Width

This is a CodeGuru survey question.


Featured


HTML5 Development Center